SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000443329 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000443329
Domain Number 1 Region: 11-93
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.000000000484
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443329   Gene: ENSG00000111203   Transcript: ENST00000540929
Sequence length 147
Comment pep:known chromosome:GRCh38:12:2812693:2830604:1 gene:ENSG00000111203 transcript:ENST00000540929 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRSVSYVQRVALEFSGSLFPHAICLGDVDNDTLNELVVGDTSGKVSVYKNDDSRPWLTCS
CQGMLTCVGVGDVCNKGKNLLVAVSAEGWFHLFDLTPAKVLDASGHHETLIGEEQRPVFK
QHIPANTKVMLISDIGGHAYLCRQPGE
Download sequence
Identical sequences A0A2J8KM98 A0A2J8S3I2
ENSP00000443329 ENSP00000443329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]