SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000443867 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000443867
Domain Number - Region: 26-89
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0863
Family Rhomboid-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443867   Gene: ENSG00000134824   Transcript: ENST00000521571
Sequence length 95
Comment pep:putative chromosome:GRCh38:11:61840297:61863077:1 gene:ENSG00000134824 transcript:ENST00000521571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHVFVLGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIVHKNWV
DLAWAVSYYIRFFITYIPFYGILGALLFLNFIRCL
Download sequence
Identical sequences F5GZ92
ENSP00000443867 ENSP00000443867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]