SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444291 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444291
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-27
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444291   Gene: ENSG00000198440   Transcript: ENST00000537943
Sequence length 129
Comment pep:known chromosome:GRCh38:19:56404014:56423047:1 gene:ENSG00000198440 transcript:ENST00000537943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKDLVTFGDVAVNFSQEEWEWLNPAQRNLYRKVMLENYRSLVSLGVSVSKPDVISLLEQ
GKEPWMVKKEGTRGPCPDWEYVFKNSEFSSKQETYEESSKVVTVGARHLSYSLDYPSLRE
DCQSEDWYK
Download sequence
Identical sequences A0A2J8JLI3 F5GZQ5
ENSP00000444291 ENSP00000444291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]