SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444313 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444313
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily RING/U-box 4.86e-18
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 2 Region: 91-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000748
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444313   Gene: ENSG00000213186   Transcript: ENST00000543469
Sequence length 323
Comment pep:known chromosome:GRCh38:3:160432445:160448937:-1 gene:ENSG00000213186 transcript:ENST00000543469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCR
SITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHC
LTIGQHHGHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQG
DKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTI
SLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV
LIPKMKISPKRMSCSWPDEGTDK
Download sequence
Identical sequences F5GZP3
ENSP00000444313 ENSP00000444313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]