SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444443 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444443
Domain Number 1 Region: 251-548
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.31e-85
Family Pancreatic carboxypeptidases 0.00000000169
Further Details:      
 
Domain Number 2 Region: 682-966
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-67
Family Pancreatic carboxypeptidases 0.0000125
Further Details:      
 
Domain Number 3 Region: 2-136
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.5e-27
Family Pancreatic carboxypeptidases 0.0000218
Further Details:      
 
Domain Number 4 Region: 548-624
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.28e-19
Family Carboxypeptidase regulatory domain 0.0000281
Further Details:      
 
Domain Number 5 Region: 136-222
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.67e-17
Family Carboxypeptidase regulatory domain 0.00074
Further Details:      
 
Domain Number 6 Region: 967-1065
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000000186
Family Carboxypeptidase regulatory domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444443   Gene: ENSG00000108582   Transcript: ENST00000543464
Sequence length 1133
Comment pep:known chromosome:GRCh38:17:30380236:30465017:1 gene:ENSG00000108582 transcript:ENST00000543464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFVLSGNLHGGSVVASYPFDDSPEHKATGIYSKTSDDEVFKYLAKAYASNHPIMKTGEP
HCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQLRQEWE
NNRESLITLIEKVHIGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGT
YNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPTVTSVIPDTTEAVSTASTVAIPNILS
GTSSSYQPIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYVMEISDNP
GVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVHNTRIHLMPSMN
PDGYEKSQEGDSISVIGRNNSNNFDLNRNFPDQFVQITDPTQPETIAVMSWMKSYPFVLS
ANLHGGSLVVNYPFDDDEQGLATYSKSPDDAVFQQIALSYSKENSQMFQGRPCKNMYPNE
YFPHGITNGASWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPLEKELPNFWEQNRRSLIQ
FMKQVHQGVRGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTYKITASAR
GYNPVTKNVTVKSEGAIQVNFTLVRSSTDSNNESKKGKGASSSTNDASDPTTKEFETLIK
DLSAENGLESLMLRSSSNLALALYRYHSYKDLSEFLRGLVMNYPHITNLTNLGQSTEYRH
IWSLEISNKPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPAVTQLVDR
TRIVIVPSLNPDGRERAQEKDCTSKIGQTNARGKDLDTDFTNNASQPETKAIIENLIQKQ
DFSLSVALDGGSMLVTYPYDKPVQTVENKETLKHLASLYANNHPSMHMGQPSCPNKSDEN
IPGGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAARLPSLWADNKRSLLSM
LVEVHKGVHGFVKDKTGKPISKAVIVLNEGIKVQTKEGGYFHVLLAPGVHNIIAIADGYQ
QQHSQVFVHHDAASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTACIIWCICSIKS
NRHKDGFHRLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
Download sequence
Identical sequences ENSP00000444443 NP_001186704.1.87134 NP_001186704.1.92137 ENSP00000444443 gi|315138990|ref|NP_001186704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]