SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444531 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000444531
Domain Number - Region: 8-49
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00576
Family AN1-like Zinc finger 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444531   Gene: ENSG00000197614   Transcript: ENST00000543467
Sequence length 79
Comment pep:putative chromosome:GRCh38:12:8641246:8650554:-1 gene:ENSG00000197614 transcript:ENST00000543467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRS
NYFRLPPCENVDLQRPNGL
Download sequence
Identical sequences A0A2J8TC08 H0YGS3
ENSP00000444531 ENSP00000444531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]