SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444917 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444917
Domain Number 1 Region: 143-265
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.4e-41
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000027
Further Details:      
 
Domain Number 2 Region: 74-149
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-18
Family Cold shock DNA-binding domain-like 0.0000318
Further Details:      
 
Domain Number 3 Region: 25-74
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000471
Family ECR1 N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444917   Gene: ENSG00000130713   Transcript: ENST00000546165
Sequence length 267
Comment pep:known chromosome:GRCh38:9:130693760:130704894:1 gene:ENSG00000130713 transcript:ENST00000546165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV
ERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGEL
RRRSAEDELAMRGFLQEGDLISGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIY
PTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPH
QIKDILKPEIMEEIVMETRQRLLEQEG
Download sequence
Identical sequences A0A2I3HQB2 A0A2I3RR83 A0A2J8UJG7
NP_001269637.1.87134 NP_001269637.1.92137 XP_001165883.1.37143 XP_003276786.1.23891 XP_003822424.1.60992 XP_016817366.1.37143 ENSP00000444917 ENSP00000444917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]