SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445598 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445598
Domain Number 1 Region: 34-140
Classification Level Classification E-value
Superfamily SufE/NifU 3.4e-42
Family NifU/IscU domain 0.00000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445598   Gene: ENSG00000136003   Transcript: ENST00000535729
Sequence length 154
Comment pep:putative chromosome:GRCh38:12:108562601:108568547:1 gene:ENSG00000136003 transcript:ENST00000535729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGAFRLRRAASALLLRSPRLPARELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVG
TGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTI
KNTDIAKELCLPPVKLHCSKSVLFPAEEKTQLSP
Download sequence
Identical sequences B4DNC9
ENSP00000445598 ENSP00000446606 NP_001288069.1.87134 NP_001288069.1.92137 NP_001306971.1.87134 NP_001306971.1.92137 ENSP00000445598 ENSP00000446606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]