SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445769 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000445769
Domain Number - Region: 10-33
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0144
Family Integrin alpha N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445769   Gene: ENSG00000111203   Transcript: ENST00000537851
Sequence length 56
Comment pep:known chromosome:GRCh38:12:2812685:2824502:1 gene:ENSG00000111203 transcript:ENST00000537851 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRSVSYVQRVALEFSGSLFPHAICLGDVDNDTMEMGVVSWWWATQTVWCELSAGRS
Download sequence
Identical sequences A0A2I2Y6P9 A0A2I3S4W3 A0A2J8S3E6 A0A2K5EU06 A0A2K5TY81 A0A2K5ZHD1 A0A2K6D9G3 A0A2K6P231 F5H1D0
ENSP00000445769 ENSP00000445769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]