SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000446062 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000446062
Domain Number 1 Region: 37-128
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 6.54e-22
Family Supernatant protein factor (SPF), C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446062   Gene: ENSG00000166557   Transcript: ENST00000536821
Sequence length 155
Comment pep:novel chromosome:GRCh38:15:79311156:79384721:1 gene:ENSG00000166557 transcript:ENST00000536821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSTVPRSASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITG
GHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQV
GDEPPILPDMGNRVTALTQGPSASPTPTPPLRVPV
Download sequence
Identical sequences F5H4M7
ENSP00000446062 NP_001288132.1.87134 NP_001288132.1.92137 ENSP00000446062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]