SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000446399 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000446399
Domain Number 1 Region: 572-928
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.28e-110
Family PDEase 0.00000222
Further Details:      
 
Domain Number 2 Region: 385-567
Classification Level Classification E-value
Superfamily GAF domain-like 5.67e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 216-398
Classification Level Classification E-value
Superfamily GAF domain-like 1.24e-33
Family GAF domain 0.0000000179
Further Details:      
 
Domain Number 4 Region: 36-188
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000196
Family GAF domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446399   Gene: ENSG00000186642   Transcript: ENST00000540345
Sequence length 932
Comment pep:putative chromosome:GRCh38:11:72577296:72669064:-1 gene:ENSG00000186642 transcript:ENST00000540345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKQRIQEGKSLAHRRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDISGLQRAVKE
ALSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCNGLGFSDLPG
KPLARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALR
RVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKV
LQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVVEDKKSIQLK
DLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHC
FHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEI
CSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYR
GVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIA
HSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRS
LPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCY
LLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERH
HFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYD
RNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMD
REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPS
NNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE
Download sequence
Identical sequences A0A2I3SX73
gi|226246591|ref|NP_001139681.1| ENSP00000446399 NP_001139681.1.87134 NP_001139681.1.92137 ENSP00000411657 ENSP00000446399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]