SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000446610 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000446610
Domain Number - Region: 8-113
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0558
Family Di-heme elbow motif 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446610   Gene: ENSG00000258289   Transcript: ENST00000551093
Sequence length 126
Comment pep:putative chromosome:GRCh38:14:64914477:64944056:1 gene:ENSG00000258289 transcript:ENST00000551093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPVDCVAMCGDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEE
IVTYDHLCKNCHHVIARHEYTFSIMDEFQDKIKGTLRRRVCHFLGEKRSFQCLSSCQAEE
TKLCLS
Download sequence
Identical sequences H0YHA3
ENSP00000446610 ENSP00000446610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]