SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000446707 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000446707
Domain Number 1 Region: 86-160
Classification Level Classification E-value
Superfamily Cyclin-like 1.81e-21
Family Transcription factor IIB (TFIIB), core domain 0.0085
Further Details:      
 
Domain Number 2 Region: 4-48
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000317
Family Transcriptional factor domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446707   Gene: ENSG00000185024   Transcript: ENST00000548421
Sequence length 208
Comment pep:putative chromosome:GRCh38:14:105256186:105301278:-1 gene:ENSG00000185024 transcript:ENST00000548421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSL
DGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSR
HLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVDSLRPASFPTWGCDLGVVTRVV
TGVYPRCLHASQWPVCAACPVRKFWSVG
Download sequence
Identical sequences K7DKE2 V9HVY2
NP_001229719.1.87134 NP_001229719.1.92137 gi|338753414|ref|NP_001229719.1| ENSP00000446707 ENSP00000446707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]