SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447347 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447347
Domain Number 1 Region: 19-100
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0000000000000445
Family Integrin alpha N-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447347   Gene: ENSG00000161638   Transcript: ENST00000553071
Sequence length 120
Comment pep:known chromosome:GRCh38:12:54405194:54419127:-1 gene:ENSG00000161638 transcript:ENST00000553071 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPGTDGVSVLVGAPKA
NTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGMRSTVQLAHREGATERPRGHLLPLHR
Download sequence
Identical sequences H0YHL9
ENSP00000447347 ENSP00000447347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]