SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447455 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447455
Domain Number 1 Region: 117-180
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 5.1e-20
Family Carboxypeptidase regulatory domain 0.0000224
Further Details:      
 
Domain Number 2 Region: 14-116
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.07e-20
Family Pancreatic carboxypeptidases 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447455   Gene: ENSG00000135678   Transcript: ENST00000551897
Sequence length 198
Comment pep:putative chromosome:GRCh38:12:68842208:68870238:-1 gene:ENSG00000135678 transcript:ENST00000551897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPFDNGVQATGALYSRSLTPDDDVFQYLAHTYASRNPNMKKGDECKNKMNFPNGVTNGYS
WYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNNKASLIEYIKQVHLGVKG
QVFDQNGNPLPNVIVEVQDRKHICPYRTNKYGEYYLLLLPGSYIINVTVPGHDPHITKLR
SFACNRGQDEFCLTSLMS
Download sequence
Identical sequences H0YHN7
ENSP00000447455 ENSP00000447455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]