SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447676 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447676
Domain Number 1 Region: 13-108
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000841
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447676   Gene: ENSG00000111300   Transcript: ENST00000547133
Sequence length 141
Comment pep:putative chromosome:GRCh38:12:112078682:112108743:-1 gene:ENSG00000111300 transcript:ENST00000547133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTTGASGPFTVLKAIGLQRTGKQEEAFTLAQEVAALEPTDDNSLQALTILYREMHRPELV
TKLYEAAVKKVPNSEEYHSHLFMAYARVGEYKKMQQAGMALYKIVPKNPYYFWSVMSLIM
QSISAQDENLSKTMFLPLAER
Download sequence
Identical sequences H0YHR9
ENSP00000447676 ENSP00000447676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]