SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447771 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447771
Domain Number 1 Region: 28-96
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000803
Family FHA domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447771   Gene: ENSG00000224587   Transcript: ENST00000552474
Sequence length 142
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_COX_CTG1:30703067:30706934:-1 gene:ENSG00000224587 transcript:ENST00000552474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMP
DCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNVPSPGCLSALCLPGPSDSRRDTQS
TGRNSTPEASVGGLGGGSRFSF
Download sequence
Identical sequences A0A087X0R2
ENSP00000447771 ENSP00000447851 ENSP00000447883 ENSP00000448066 ENSP00000448232 ENSP00000449936 ENSP00000450002 ENSP00000483601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]