SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000448050 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000448050
Domain Number - Region: 42-61,88-121
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0134
Family Di-heme elbow motif 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448050   Gene: ENSG00000258289   Transcript: ENST00000549115
Sequence length 139
Comment pep:known chromosome:GRCh38:14:64914361:64934385:1 gene:ENSG00000258289 transcript:ENST00000549115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQPYLSSREVSSSRKRWRTFPVDCVAMCGDCVEKEYPNRGNTCLENGSFLLNFTGCAVC
SKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGK
AEDTISILPDDPRQMTLLF
Download sequence
Identical sequences A0A024R6B7 A0A2I3HWK9 Q5R6Q5 Q8WUH1
ENSPPYP00000006713 NP_001126496.1.23681 NP_001190992.1.87134 NP_001190992.1.92137 XP_003267868.1.23891 XP_008976010.1.60992 XP_009426217.1.37143 ENSPPYP00000006713 9600.ENSPPYP00000006713 ENSP00000448050 ENSP00000448050 gi|323276622|ref|NP_001190992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]