SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000448315 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448315
Domain Number 1 Region: 16-78
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.27e-17
Family Phosphofructokinase 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448315   Gene: ENSG00000152556   Transcript: ENST00000551485
Sequence length 102
Comment pep:known chromosome:GRCh38:12:48119352:48133320:1 gene:ENSG00000152556 transcript:ENST00000551485 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIKEATWESVSMMLQLLSSLKIHGQKFNMQCLVKALPRC
Download sequence
Identical sequences A0A2I2ZP04 A0A2I3FW96 A0A2I3TPV9 A0A2J8WD15 F8VSF7
ENSP00000448315 ENSP00000448315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]