SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000448566 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000448566
Domain Number - Region: 105-141
Classification Level Classification E-value
Superfamily SIS domain 0.0756
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448566   Gene: ENSG00000139324   Transcript: ENST00000551088
Sequence length 146
Comment pep:novel chromosome:GRCh38:12:88142307:88160710:1 gene:ENSG00000139324 transcript:ENST00000551088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANINLKEITLIVGVVTACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEVTGVVGRAELLSSIFFLAAFLSYTRSKGPDNSIIWTPIALTVFLVAVATLCKEQGIT
VVGICCVYEVFIAQGYTLPLLCTTAG
Download sequence
Identical sequences A0A2J8MIK4 A0A2J8SW44
ENSP00000448566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]