SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000448815 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448815
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-26
Family SH2 domain 0.00000167
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000000379
Family SOCS box-like 0.0000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448815   Gene: ENSG00000120833   Transcript: ENST00000549206
Sequence length 198
Comment pep:known chromosome:GRCh38:12:93570399:93576174:1 gene:ENSG00000120833 transcript:ENST00000549206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
Download sequence
Identical sequences A0A024RBD2 O14508
ENSP00000339428 GO.35271 HR2882 gi|4507263|ref|NP_003868.1| 9606.ENSP00000339428 ENSP00000339428 ENSP00000442898 ENSP00000447161 ENSP00000448815 ENSP00000449227 ENSP00000339428 ENSP00000442898 ENSP00000447161 ENSP00000448815 ENSP00000449227 ENSP00000481249 NP_001257396.1.87134 NP_001257396.1.92137 NP_001257397.1.87134 NP_001257397.1.92137 NP_001257398.1.87134 NP_001257398.1.92137 NP_001257399.1.87134 NP_001257399.1.92137 NP_001257400.1.87134 NP_001257400.1.92137 NP_003868.1.87134 NP_003868.1.92137 XP_016875645.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]