SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000448943 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448943
Domain Number 1 Region: 5-80
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.14e-23
Family Double-stranded RNA-binding domain (dsRBD) 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448943   Gene: ENSG00000139546   Transcript: ENST00000549679
Sequence length 88
Comment pep:known chromosome:GRCh38:12:53501605:53506396:1 gene:ENSG00000139546 transcript:ENST00000549679 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTGQGPSKK
AAKHKAAEVALKHLKGGSMLEPALEDSR
Download sequence
Identical sequences A0A2J8KD03 A0A2J8SX29 F8VYK6
ENSP00000448943 ENSP00000448943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]