SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000449004 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000449004
Domain Number 1 Region: 87-178
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 5.36e-16
Family Creatinase/aminopeptidase 0.00000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449004   Gene: ENSG00000111142   Transcript: ENST00000553151
Sequence length 178
Comment pep:novel chromosome:GRCh38:12:95474152:95494974:1 gene:ENSG00000111142 transcript:ENST00000553151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAALEDKERDED
DEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR
TAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLED
Download sequence
Identical sequences A0A2J8N0S7 F8VY03
ENSP00000449004 ENSP00000449004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]