SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000449184 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000449184
Domain Number - Region: 8-57
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0398
Family Cytochrome c3-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449184   Gene: ENSG00000258289   Transcript: ENST00000547625
Sequence length 95
Comment pep:putative chromosome:GRCh38:14:64924010:64930937:1 gene:ENSG00000258289 transcript:ENST00000547625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMD
EFQVAIQIAMPGGLKQWKYLRTVKDLEEDVFLFYF
Download sequence
Identical sequences H0YID9
ENSP00000449184 ENSP00000449184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]