SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000449404 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000449404
Domain Number 1 Region: 348-425
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.26e-25
Family Intermediate filament protein, coiled coil region 0.00025
Further Details:      
 
Domain Number 2 Region: 118-152
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000628
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 154-225
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000194
Family Intermediate filament protein, coiled coil region 0.012
Further Details:      
 
Domain Number 4 Region: 242-349
Classification Level Classification E-value
Superfamily Prefoldin 0.0000575
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449404   Gene: ENSG00000170421   Transcript: ENST00000552150
Sequence length 511
Comment pep:putative chromosome:GRCh38:12:52897297:52926469:-1 gene:ENSG00000170421 transcript:ENST00000552150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGVSWSQDLQEGISAWFGPPASTPASTMSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSR
ISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEK
EQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLE
TLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELES
RLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIAN
RSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLE
AAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYR
KLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSF
SRTSSSRAVVVKKIETRDGKLVSESSDVLPK
Download sequence
Identical sequences ENSP00000449404 NP_001243211.1.87134 NP_001243211.1.92137 ENSP00000447566 ENSP00000449404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]