SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000449693 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000449693
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000173
Family DEATH domain, DD 0.0000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449693   Gene: ENSG00000198001   Transcript: ENST00000547521
Sequence length 60
Comment pep:known chromosome:GRCh38:12:43758951:43786414:1 gene:ENSG00000198001 transcript:ENST00000547521 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRCCSQNC
Download sequence
Identical sequences A0A2I2ZTX3 A0A2I3G6P7 A0A2I3LXU7 A0A2I3RX60 A0A2K5JMU3 A0A2K5MIJ2 A0A2K5V433 A0A2K5YF18 A0A2K6DC27 A0A2K6MSV3 F8VVZ1
ENSP00000448197 ENSP00000449553 ENSP00000449693 ENSP00000449859 ENSP00000448197 ENSP00000449553 ENSP00000449693 ENSP00000449859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]