SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000449835 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000449835
Domain Number 1 Region: 16-117
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.7e-31
Family Phosphofructokinase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449835   Gene: ENSG00000152556   Transcript: ENST00000549003
Sequence length 117
Comment pep:known chromosome:GRCh38:12:48105482:48132980:1 gene:ENSG00000152556 transcript:ENST00000549003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIG
Download sequence
Identical sequences A0A2J8LQE3 A0A2J8WD27
ENSP00000449835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]