SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000449898 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000449898
Domain Number 1 Region: 19-100
Classification Level Classification E-value
Superfamily Lysozyme-like 6.17e-37
Family C-type lysozyme 0.00000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449898   Gene: ENSG00000090382   Transcript: ENST00000549690
Sequence length 137
Comment pep:putative chromosome:GRCh38:12:69348384:69353495:1 gene:ENSG00000090382 transcript:ENST00000549690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRA
TNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSGWHGEIVVKTEMSVSMFKVV
ECNSRIFLLQLILSLSH
Download sequence
Identical sequences A0A0B4J259
ENSP00000449898 ENSP00000449898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]