SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000449955 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000449955
Domain Number - Region: 19-91
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0222
Family Rhomboid-like 0.021
Further Details:      
 
Domain Number - Region: 90-130
Classification Level Classification E-value
Superfamily FLJ32549 domain-like 0.0301
Family FLJ32549 domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449955   Gene: ENSG00000139291   Transcript: ENST00000549735
Sequence length 298
Comment pep:known chromosome:GRCh38:12:71686496:71699849:1 gene:ENSG00000139291 transcript:ENST00000549735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDLNDNICKRYIKMITNIVILSLIICISLAFWIISMTASTYYGNLRPISPWRWLFSVVV
PVLIVSNGLKKKSLDHSGALGGLVVGFILTIANFSFFTSLLMFFLSSSKLTKWKGEVKKR
LDSEYKEGGQRNWVQVFCNGAVPTELALLYMIENGPGEIPVDFSKQYSASWMCLSLLAAL
ACSAGDTWASEVGPVLSKSSPRLITTWEKVPVGTNGGVTVVGLVSSLLGGTFVGIAYFLT
QLIFVNDLDISAPQWPIIAFGGLAGLLGSIVDSYLGATMQYTGKNIPSFLQLIGMLKK
Download sequence
Identical sequences A0A024RBE1
ENSP00000449955 ENSP00000449955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]