SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000449967 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000449967
Domain Number 1 Region: 72-164
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.7e-24
Family D-aminoacid oxidase-like 0.00000546
Further Details:      
 
Domain Number 2 Region: 8-85,149-165
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000000177
Family D-aminoacid oxidase, N-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449967   Gene: ENSG00000110887   Transcript: ENST00000547768
Sequence length 167
Comment pep:putative chromosome:GRCh38:12:108880109:108899432:1 gene:ENSG00000110887 transcript:ENST00000547768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVNCTG
VWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQ
LGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIR
Download sequence
Identical sequences ENSP00000449967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]