SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450091 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450091
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily Phosphofructokinase 6.28e-20
Family Phosphofructokinase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450091   Gene: ENSG00000152556   Transcript: ENST00000553055
Sequence length 97
Comment pep:novel chromosome:GRCh38:12:48141973:48145051:1 gene:ENSG00000152556 transcript:ENST00000553055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPFVVIPATVSNNVPGSDFSVGADTALNTICTANVEHLVQKMKTTVKRGLVLRNEKCNEN
YTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPF
Download sequence
Identical sequences H0YIS9
ENSP00000450091 ENSP00000450091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]