SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450307 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450307
Domain Number 1 Region: 8-48
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000392
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450307   Gene: ENSG00000111335   Transcript: ENST00000551603
Sequence length 60
Comment pep:known chromosome:GRCh38:12:112978602:112998410:1 gene:ENSG00000111335 transcript:ENST00000551603 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIA
Download sequence
Identical sequences A0A2J8MYF7 F8VPI5
ENSP00000450307 ENSP00000450307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]