SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450369 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450369
Domain Number 1 Region: 16-133
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.14e-38
Family Phosphofructokinase 0.0000853
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450369   Gene: ENSG00000152556   Transcript: ENST00000550345
Sequence length 157
Comment pep:known chromosome:GRCh38:12:48105139:48133360:1 gene:ENSG00000152556 transcript:ENST00000550345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLN
Download sequence
Identical sequences A0A2J8LQE1 A0A2J8WD08 F8VNX2
ENSP00000450369 ENSP00000450369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]