SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450578 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450578
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.000000000144
Family Integrin alpha N-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450578   Gene: ENSG00000135424   Transcript: ENST00000557257
Sequence length 153
Comment pep:putative chromosome:GRCh38:12:55698774:55712118:-1 gene:ENSG00000135424 transcript:ENST00000557257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGRCFVLSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPG
TYNWKGLLFVTNIDSSDPDQLVYKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLVRAEE
LSFVAGAPRANHKGAVVILRKDSASRLVPEVML
Download sequence
Identical sequences A0A2J8Q1A4 G3V2C6
ENSP00000450578 ENSP00000450578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]