SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450693 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450693
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000434
Family Integrin domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450693   Gene: ENSG00000135424   Transcript: ENST00000554327
Sequence length 109
Comment pep:known chromosome:GRCh38:12:55684572:55696427:-1 gene:ENSG00000135424 transcript:ENST00000554327 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XVKDKLRAIVVTLSYSLQTPRLRRQAPGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGED
KICQSNLQLVRARFCTRVSDTEFQPLPMRSHSACPMRMPPMLSVSWGTP
Download sequence
Identical sequences H0YJ26
ENSP00000450693 ENSP00000450693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]