SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450812 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450812
Domain Number 1 Region: 20-206
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.85e-55
Family Poly(A) polymerase, PAP, N-terminal domain 0.0000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450812   Gene: ENSG00000090060   Transcript: ENST00000557471
Sequence length 238
Comment pep:putative chromosome:GRCh38:14:96502441:96532248:1 gene:ENSG00000090060 transcript:ENST00000557471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFPVTTQGSQQTQPPQKHYGITSPISLAAPKETDCVLTQKLIETLKPFGVFEEEEELQR
RILILGKLNNLVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVA
PRHVDRSDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPE
DLDLRDDSLLKNLDIRCIRSLNGMRKPTSFCVLQFLSDISCFYTSFVLKLFIAILLTQ
Download sequence
Identical sequences A0A0C4DGK1
ENSP00000450812 ENSP00000450812 NP_001238936.1.87134 NP_001238936.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]