SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450928 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450928
Domain Number 1 Region: 45-82
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.00000222
Family Supernatant protein factor (SPF), C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450928   Gene: ENSG00000134970   Transcript: ENST00000508420
Sequence length 82
Comment pep:known chromosome:GRCh38:5:115620628:115632992:-1 gene:ENSG00000134970 transcript:ENST00000508420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCT
LEFQVITGGHYDVDCRLEDPDG
Download sequence
Identical sequences A0A2J8KJ26
ENSP00000450928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]