SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450939 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450939
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.26e-22
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450939   Gene: ENSG00000139977   Transcript: ENST00000555166
Sequence length 104
Comment pep:putative chromosome:GRCh38:14:57390544:57410330:1 gene:ENSG00000139977 transcript:ENST00000555166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGEECVGAIVCKLDMHKKMFRRGYIAMLAVDSKYRRNGIGTNLVKKAIYAMVEGDCDEV
VLETEITNKSALKLYENLGFVRDKRLFRYYLNGVDALRLKLWLR
Download sequence
Identical sequences A0A2J8PHR3 A0A2J8WL55 A0A2K6UFA2 B4DK34 F7HN92
ENSCJAP00000034626 ENSP00000450939 ENSP00000450939 XP_005978591.1.78601 XP_013010771.1.53824 XP_014952576.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]