SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000451074 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451074
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 2.75e-27
Family Transcription factor STAT-4 N-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451074   Gene: ENSG00000166888   Transcript: ENST00000553499
Sequence length 154
Comment pep:known chromosome:GRCh38:12:57106708:57132139:-1 gene:ENSG00000166888 transcript:ENST00000553499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDT
VQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFKTGLRRLQHRVGEIHLLREALQKG
Download sequence
Identical sequences A0A2J8KWE7 G3V370
ENSP00000451074 ENSP00000451074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]