SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000451331 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451331
Domain Number 1 Region: 87-146
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000379
Family HAT/Suf repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451331   Gene: ENSG00000185246   Transcript: ENST00000554429
Sequence length 152
Comment pep:known chromosome:GRCh38:14:45095239:45115601:1 gene:ENSG00000185246 transcript:ENST00000554429 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MQNSHMDEYRNSSNGSTGNSSEVVVEHPTDFSTEIMNVTEMEQSPDDSPNVNASTEETEM
ASAVDLPVTLTETEANFPPEYEKFWKTVENNPQDFTGWVYLLQYVEQENHLMAARKAFDR
FFIHYPYCYGYWKKYADLEKRHDNIKPSDEVR
Download sequence
Identical sequences A0A2J8MIF5 F8WB90
ENSP00000390867 ENSP00000451331 ENSP00000451334 ENSP00000390867 ENSP00000451331 ENSP00000451334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]