SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000451479 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451479
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SNARE-like 7.32e-42
Family Clathrin coat assembly domain 0.0000676
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451479   Gene: ENSG00000100478   Transcript: ENST00000557346
Sequence length 133
Comment pep:known chromosome:GRCh38:14:31025106:31092999:1 gene:ENSG00000100478 transcript:ENST00000557346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYR
QYAALFIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDIMFNLDKVHIILDEMVLN
GCIVETNRARILA
Download sequence
Identical sequences A0A2J8QL23 A0A2J8THW2 G3V3X7
ENSP00000451479 ENSP00000451479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]