SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452216 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452216
Domain Number 1 Region: 7-224
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.5e-19
Family Biotin biosynthesis protein BioH 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452216   Gene: ENSG00000165795   Transcript: ENST00000554104
Sequence length 284
Comment pep:putative chromosome:GRCh38:14:21016772:21022820:-1 gene:ENSG00000165795 transcript:ENST00000554104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGA
GAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEEL
SGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPH
EDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSR
SRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC
Download sequence
Identical sequences G3V578
ENSP00000452216 ENSP00000452216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]