SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452548 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452548
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000106
Family Biotin biosynthesis protein BioH 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452548   Gene: ENSG00000165795   Transcript: ENST00000557676
Sequence length 149
Comment pep:known chromosome:GRCh38:14:21020561:21025140:-1 gene:ENSG00000165795 transcript:ENST00000557676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLN
YKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQY
LNFSTIIGVGVGAGAYILARYALNHPDTV
Download sequence
Identical sequences A0A2J8JHU5 A0A2J8TSP3 G3V5V9
ENSP00000452548 ENSP00000452548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]