SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452740 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452740
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.19e-30
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.001
Further Details:      
 
Domain Number 2 Region: 100-142
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00000156
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452740   Gene: ENSG00000185418   Transcript: ENST00000558533
Sequence length 148
Comment pep:known chromosome:GRCh38:15:101654213:101708828:-1 gene:ENSG00000185418 transcript:ENST00000558533 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
EVSKEILLEMFKYNKFKCRILNEKVNTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFK
NSSTYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLS
PGSCFFLPRGAFIYNTLTDFIRMQDRCG
Download sequence
Identical sequences H0YKB9
ENSP00000452740 ENSP00000452740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]