SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000453048 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453048
Domain Number 1 Region: 57-193
Classification Level Classification E-value
Superfamily Cytokine 1.22e-51
Family Fibroblast growth factors (FGF) 0.000000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453048   Gene: ENSG00000140285   Transcript: ENST00000560765
Sequence length 194
Comment pep:known chromosome:GRCh38:15:49423258:49484559:1 gene:ENSG00000140285 transcript:ENST00000560765 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTK
KEQKTAHFLPMAIT
Download sequence
Identical sequences A0A096NM19 A0A0D9RE41 A0A2J8VBG1 A0A2K5JPV3 A0A2K5NU53 A0A2K5VXJ6 A0A2K6A0M8 A0A2K6CE39 F7A1B0 H2Q9E4 P21781 Q5RAY8
ENSPPYP00000007325 ENSP00000267843 ENSP00000453048 ENSP00000478148 ENSPTRP00000012061 ENSPANP00000014028 ENSP00000267843 ENSP00000453048 ENSP00000267843 gi|4503705|ref|NP_002000.1| ENSPTRP00000012061 ENSMMUP00000012883 9544.ENSMMUP00000012883 9598.ENSPTRP00000012061 9600.ENSPPYP00000007325 9606.ENSP00000267843 ENSMMUP00000012883 NP_001125621.1.23681 NP_001181542.1.72884 NP_002000.1.87134 NP_002000.1.92137 XP_001167319.1.37143 XP_003831549.1.60992 XP_005559561.1.63531 XP_008014842.1.81039 XP_011754704.1.29376 XP_011783978.1.43180 XP_011822694.1.47321 XP_011920681.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]