SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000453464 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453464
Domain Number 1 Region: 19-248
Classification Level Classification E-value
Superfamily Annexin 5.63e-88
Family Annexin 0.000000000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453464   Gene: ENSG00000182718   Transcript: ENST00000559176
Sequence length 248
Comment pep:novel chromosome:GRCh38:15:60351192:60374505:-1 gene:ENSG00000182718 transcript:ENST00000559176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNQILIWCQQCQENSPISSVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSAL
SGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMY
KTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVP
KWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFA
DRLYDSMK
Download sequence
Identical sequences H0YM50
ENSP00000453464 ENSP00000453464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]