SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000453488 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453488
Domain Number 1 Region: 11-136
Classification Level Classification E-value
Superfamily EF-hand 5.83e-26
Family Calmodulin-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453488   Gene: ENSG00000136425   Transcript: ENST00000557846
Sequence length 138
Comment pep:novel chromosome:GRCh38:15:78105012:78131433:-1 gene:ENSG00000136425 transcript:ENST00000557846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKQTIFTEEQLDNYQENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKAN
YAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADF
EDMIAKAPDFLSTFHIRI
Download sequence
Identical sequences A0A2I2YQ45 A0A2I3GRF9 A0A2I3LS69 A0A2I3SHU4 A0A2J8SK67 A0A2K5HGU2 A0A2K5LDU1 A0A2K5U6Q1 A0A2K6C1L0 A0A2K6MJ76 A0A2K6QL75 F6YDU8
NP_001258818.1.87134 NP_001258818.1.92137 XP_004088368.1.23891 XP_011793827.1.43180 ENSP00000453488 ENSP00000453488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]