SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000453676 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453676
Domain Number 1 Region: 58-117
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000102
Family SH2 domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453676   Gene: ENSG00000138606   Transcript: ENST00000561239
Sequence length 161
Comment pep:putative chromosome:GRCh38:15:45170208:45173658:-1 gene:ENSG00000138606 transcript:ENST00000561239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSPSLPDGDRDISGPASPLPEPSLEDSSAQFEGPEKSCLSPGREEKGRLPPRLSAGNPKS
AKPLSMEPSSPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLLSYSRSLNCK
IKEAFPRKVFVKNLIYITSEMCIALKIIKFMEHTKQPVYHF
Download sequence
Identical sequences H0YMN4
ENSP00000453676 ENSP00000453676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]