SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000453701 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453701
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.07e-16
Family Transglutaminase, two C-terminal domains 0.0023
Further Details:      
 
Domain Number 2 Region: 75-127
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000000000000445
Family Transglutaminase, two C-terminal domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453701   Gene: ENSG00000092295   Transcript: ENST00000559669
Sequence length 128
Comment pep:putative chromosome:GRCh38:14:24254123:24255056:-1 gene:ENSG00000092295 transcript:ENST00000559669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVK
ESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQ
RPKILNVG
Download sequence
Identical sequences H0YMQ8
ENSP00000453701 ENSP00000453701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]