SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000453962 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000453962
Domain Number - Region: 51-113
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0746
Family Rhomboid-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453962   Gene: ENSG00000232070   Transcript: ENST00000418511
Sequence length 217
Comment pep:known chromosome:GRCh38:14:21098937:21103724:1 gene:ENSG00000232070 transcript:ENST00000418511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDRAGEQEQERHSLRLEKLQHWARHRQSGHLLVLAVSQLWLAVVVVPLAVSVACLNSDC
HMATALPLGPGASGLLTGTVTLELRRAPRLWKVRAMMIFNTFNLILGFIVVVVEVMKTAL
GPAPTASSQHAGLLVLELSAEAFTLGGVLVSVHALFLLSQRKPGCCRSQSLHYQELQEGF
SELEEVPGLENGPTVASTGANERVGQREQTRAALLPP
Download sequence
Identical sequences P0C7T8
ENSP00000451229 NP_001140155.1.87134 NP_001140155.1.92137 XP_006720296.1.92137 XP_011535380.1.92137 XP_011535381.1.92137 9606.ENSP00000395470 gi|226442725|ref|NP_001140155.1| ENSP00000451229 ENSP00000453962 ENSP00000451229 ENSP00000453962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]